General Information

  • ID:  hor005277
  • Uniprot ID:  P29071
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPVKPENPGEDAPTEELAKYYTALRHYINLITRQRY
  • Length:  36(1-36)
  • Propeptide:  YPVKPENPGEDAPTEELAKYYTALRHYINLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P29071-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P29071-F1.pdbhor005277_AF2.pdbhor005277_ESM.pdb

Physical Information

Mass: 493529 Formula: C196H298N52O58
Absent amino acids: CFMSW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -105.28 Boman Index: -8870
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 70.56
Instability Index: 6987.5 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  1459125
  • Title:  Characterization of peptides related to neuropeptide tyrosine and peptide tyrosine-tyrosine from the brain and gastrointestinal tract of teleost fish.