General Information

  • ID:  hor005275
  • Uniprot ID:  P41334
  • Protein name:  Neuropeptide F
  • Gene name:  NA
  • Organism:  Arthurdendyus triangulatus (New Zealand flatworm) (Artioposthia triangulata)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Central and peripheral nervous system, and muscular pharynx.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arthurdendyus (genus), Caenoplaninae (subfamily), Geoplanidae (family), Geoplanoidea (superfamily), Continenticola (suborder), Tricladida (order), Seriata, Rhabditophora (class), Platyhelminthes (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KVVHLRPRSSFSSEDEYQIYLRNVSKYIQLYGRPRF
  • Length:  36(1-36)
  • Propeptide:  KVVHLRPRSSFSSEDEYQIYLRNVSKYIQLYGRPRF
  • Signal peptide:  NA
  • Modification:  T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May perform an important neurotransmitter function and may regulate muscular activity.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41334-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P41334-F1.pdbhor005275_AF2.pdbhor005275_ESM.pdb

Physical Information

Mass: 505748 Formula: C202H312N58O55
Absent amino acids: ACMTW Common amino acids: RS
pI: 10.32 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -79.72 Boman Index: -10436
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 78.33
Instability Index: 5925 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  1354101
  • Title:  Neuropeptide F: primary structure from the tubellarian, Artioposthia triangulata.