General Information

  • ID:  hor005274
  • Uniprot ID:  Q28207
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  IAPP
  • Organism:  Bos taurus (Bovine)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CGTATCETQRLANFLAPSSNKLGAIFSPTKMGSNTY
  • Length:  36(37-72)
  • Propeptide:  MGILKLPVVLIVLCVALNHLEGGGKPTESHQMEKRKCGTATCETQRLANFLAPSSNKLGAIFSPTKMGSNTYGKRKKVEILKREPLSYLPI
  • Signal peptide:  MGILKLPVVLIVLCVALNHLEG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-Q28207-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005274_AF2.pdbhor005274_ESM.pdb

Physical Information

Mass: 440575 Formula: C162H259N45O53S3
Absent amino acids: DHVW Common amino acids: T
pI: 8.79 Basic residues: 3
Polar residues: 18 Hydrophobic residues: 10
Hydrophobicity: -18.33 Boman Index: -4427
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 54.44
Instability Index: 3790.83 Extinction Coefficient cystines: 1615
Absorbance 280nm: 46.14

Literature

  • PubMed ID:  19390049
  • Title:  The genome sequence of taurine cattle: a window to ruminant biology and evolution.