General Information

  • ID:  hor005266
  • Uniprot ID:  P17716
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  IAPP
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007165 signal transduction; GO:0010739 positive regulation of protein kinase A signaling; GO:0019233 sensory perception of pain; GO:0030316 osteoclast differentiation; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045453 bone resorption; GO:0045671 negative regulation of osteoclast differentiation; GO:0045779 negative regulation of bone resorption; GO:0050850 positive regulation of calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CNTATCATQRLANFLVRTSNNLGAILSPTNVGSNTY
  • Length:  36(35-70)
  • Propeptide:  MCLLKLPVVLIILSVALNHLKATPIKSHQMEKRKCNTATCATQRLANFLVRTSNNLGAILSPTNVGSNTYGKRNTIEILNRGPLNYLPL
  • Signal peptide:  MCLLKLPVVLIILSVALNHLKA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CALCR
  • Target Unid:  B3XXF2
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-P17716-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005266_AF2.pdbhor005266_ESM.pdb

Physical Information

Mass: 441171 Formula: C159H261N49O54S2
Absent amino acids: DEHKMW Common amino acids: NT
pI: 8.8 Basic residues: 2
Polar residues: 20 Hydrophobic residues: 12
Hydrophobicity: -1.94 Boman Index: -5364
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.39
Instability Index: 740 Extinction Coefficient cystines: 1615
Absorbance 280nm: 46.14

Literature

  • PubMed ID:  1543754
  • Title:  Nucleotide sequence of a cDNA for canine amylin.
  • PubMed ID:  2192709
  • Title:   Canine IAPP cDNA sequence provides important clues regarding diabetogenesis and amyloidogenesis in type 2 diabetes.