General Information

  • ID:  hor005265
  • Uniprot ID:  P80594
  • Protein name:  Egg-laying-like hormone
  • Gene name:  NA
  • Organism:  Theromyzon tessulatum (Duck leech)
  • Family:  molluscan ELH family
  • Source:  Animal
  • Expression:  L-ELH greatly increases before egg-laying, while it strongly decreases after egg-laying.|Supra, subesophageal ganglia and segmental ganglia of the ventral nerve cord and brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Theromyzon (genus), Glossiphoniidae (family), Rhynchobdellida (order), Hirudinea (subclass), Clitellata (class), Annelida (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  GSGVSNGGTEMIQLSHIRERQRYWAQDNLRRRFLEK
  • Length:  36(1-36)
  • Propeptide:  GSGVSNGGTEMIQLSHIRERQRYWAQDNLRRRFLEK
  • Signal peptide:  NA
  • Modification:  T36 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in leech reproduction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80594-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P80594-F1.pdbhor005265_AF2.pdbhor005265_ESM.pdb

Physical Information

Mass: 491426 Formula: C183H295N63O55S
Absent amino acids: CP Common amino acids: R
pI: 11.26 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -115 Boman Index: -12982
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 65
Instability Index: 6289.44 Extinction Coefficient cystines: 6990
Absorbance 280nm: 199.71

Literature

  • PubMed ID:  9387880
  • Title:  Leech egg-laying-like hormone: structure, neuronal distribution and phylogeny.