General Information

  • ID:  hor005263
  • Uniprot ID:  P80024
  • Protein name:  Pancreatic polypeptide MY (PMY)
  • Gene name:  NA
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MPPKPDNPSPDASPEELSKYMLAVRNYINLITRQRY
  • Length:  36(1-36)
  • Propeptide:  MPPKPDNPSPDASPEELSKYMLAVRNYINLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80024-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P80024-F1.pdbhor005263_AF2.pdbhor005263_ESM.pdb

Physical Information

Mass: 483026 Formula: C186H295N51O56S2
Absent amino acids: CFGHW Common amino acids: P
pI: 9.03 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: -94.17 Boman Index: -8861
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.78
Instability Index: 8272.78 Extinction Coefficient cystines: 4470
Absorbance 280nm: 127.71

Literature

  • PubMed ID:  2070789
  • Title:  Primary structure and conformational analysis of peptide methionine-tyrosine, a peptide related to neuropeptide Y and peptide YY isolated from lamprey intestine.