General Information

  • ID:  hor005260
  • Uniprot ID:  P34165
  • Protein name:  Mating hormone A-factor 1
  • Gene name:  MFA1
  • Organism:  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
  • Family:  NA
  • Source:  Fungi
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Saccharomyces cerevisiae (species), Saccharomyces (genus), Saccharomycetaceae (family), Saccharomycetales (order), Saccharomycetes (class), Saccharomycotina (subphylum), saccharomyceta, Ascomycota (phylum), Dikarya (subkingdom), Fungi (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0000772 mating pheromone activity; GO:0005186 pheromone activity
  • GO BP:  GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
  • GO CC:  GO:0005576 extracellular region; GO:0005783 endoplasmic reticulum; GO:0005886 plasma membrane; GO:0016020 membrane

Sequence Information

  • Sequence:  YIIKGVFWDPAC
  • Length:  12(22-33)
  • Propeptide:  MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA
  • Signal peptide:  NA
  • Modification:  T12 Cysteine methyl ester
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis
  • Mechanism:  Present with 28900 molecules/cell in log phase SD medium.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P34165-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005260_AF2.pdbhor005260_ESM.pdb

Physical Information

Mass: 160808 Formula: C69H98N14O16S
Absent amino acids: EHLMNQRST Common amino acids: I
pI: 6.16 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: 72.5 Boman Index: 881
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 97.5
Instability Index: 4768.33 Extinction Coefficient cystines: 6990
Absorbance 280nm: 635.45

Literature

  • PubMed ID:  3542988
  • Title:  Amino acid sequences of a-factor mating peptides from Saccharomyces cerevisiae.
  • PubMed ID:  3056940
  • Title:   Structure of Saccharomyces cerevisiae mating hormone a-factor. Identification of S-farnesyl cysteine as a structural component.