General Information

  • ID:  hor005245
  • Uniprot ID:  P06885
  • Protein name:  Gastrin
  • Gene name:  GAST
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QGPWAEEEAAYGWMDF
  • Length:  16(18-33)
  • Propeptide:  QLGPQVPAHLRTDLSKKQGPWAEEEAAYGWMDF
  • Signal peptide:  NA
  • Modification:  T16 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR
  • Target Unid:   H0VZC5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06885-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005245_AF2.pdbhor005245_ESM.pdb

Physical Information

Mass: 215475 Formula: C87H111N19O27S
Absent amino acids: CHIKLNRSTV Common amino acids: AE
pI: 3.33 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: -80.63 Boman Index: -1753
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 18.75
Instability Index: 5142.5 Extinction Coefficient cystines: 12490
Absorbance 280nm: 832.67

Literature

  • PubMed ID:  3747718
  • Title:  Guinea pig 33-amino acid gastrin.