General Information

  • ID:  hor005230
  • Uniprot ID:  P33581
  • Protein name:  Growth hormone-related protein 4
  • Gene name:  NA
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Somatotropin/prolactin family
  • Source:  animal
  • Expression:  Mid to late gestation (gestation day 15).|Placental basal zone cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IPACMVEDGGCWDPLGEAFNSATQRAETLRNL
  • Length:  32
  • Propeptide:  IPACMVEDGGCWDPLGEAFNSATQRAETLRNL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-11
  • Structure ID:  AF-P33581-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P33581-F1.pdbhor005230_AF2.pdbhor005230_ESM.pdb

Physical Information

Mass: 401902 Formula: C147H230N42O49S3
Absent amino acids: HKY Common amino acids: A
pI: 3.95 Basic residues: 2
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -23.44 Boman Index: -5107
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 70.31
Instability Index: 6088.13 Extinction Coefficient cystines: 5625
Absorbance 280nm: 181.45

Literature

  • PubMed ID:  2351117
  • Title:  Identification of a novel family of growth hormone-related proteins secreted by rat placenta.