General Information

  • ID:  hor005229
  • Uniprot ID:  B3EWY2
  • Protein name:  Natriuretic peptide Coa_NP2
  • Gene name:  NA
  • Organism:  Crotalus oreganus abyssus (Grand Canyon rattlesnake) (Crotalus abyssus)
  • Family:  Natriuretic peptide family, Snake NP subfamily
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Crotalus oreganus (species), Crotalus (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP
  • Length:  32
  • Propeptide:  SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits hypotensive and vasorelaxant effects
  • Mechanism:  The hypotensive effect is not mediated by the natriuretic peptide receptor-A (NPR1).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-24
  • Structure ID:  AF-B3EWY2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-B3EWY2-F1.pdbhor005229_AF2.pdbhor005229_ESM.pdb

Physical Information

Mass: 397208 Formula: C149H237N41O45S3
Absent amino acids: AEHNV Common amino acids: G
pI: 8.22 Basic residues: 3
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: 10.63 Boman Index: -2778
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.31
Instability Index: 5717.19 Extinction Coefficient cystines: 7115
Absorbance 280nm: 229.52

Literature

  • PubMed ID:  22617223
  • Title:  Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom.