General Information

  • ID:  hor005224
  • Uniprot ID:  P01262
  • Protein name:  Calcitonin
  • Gene name:  NA
  • Organism:  Anguilla japonica (Japanese eel)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha, Elopocephala, Elopocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP
  • Length:  32(1-32)
  • Propeptide:  CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP
  • Signal peptide:  NA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-P01262-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01262-F1.pdbhor005224_AF2.pdbhor005224_ESM.pdb

Physical Information

Mass: 397103 Formula: C146H242N42O48S2
Absent amino acids: FIMW Common amino acids: L
pI: 8.23 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 8
Hydrophobicity: -30.31 Boman Index: -4468
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 82.19
Instability Index: 2253.75 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  10387083
  • Title:  Effects of glycosylation on the structure and dynamics of eel calcitonin in micelles and lipid bilayers determined by nuclear magnetic resonance spectroscopy.