General Information

  • ID:  hor005219
  • Uniprot ID:  P82372
  • Protein name:  Diuretic hormone class 2
  • Gene name:  NA
  • Organism:  Diploptera punctata (Pacific beetle cockroach)
  • Family:  Diuretic hormone class 2 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Diploptera (genus), Diplopterinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007589 body fluid secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Length:  31(1-31)
  • Propeptide:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Signal peptide:  NA
  • Modification:  T31 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  CAMP:16 nM Fluid secretion???.8 nM
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82372-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P82372-F1.pdbhor005219_AF2.pdbhor005219_ESM.pdb

Physical Information

Mass: 352369 Formula: C130H207N39O40S
Absent amino acids: CEITVW Common amino acids: G
pI: 9.3 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 12
Hydrophobicity: 13.87 Boman Index: -900
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 82.26
Instability Index: 3098.39 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  10841553
  • Title:  Cockroach diuretic hormones: characterization of a calcitonin-like peptide in insects.s