General Information

  • ID:  hor005215
  • Uniprot ID:  P85830
  • Protein name:  Diuretic hormone class 2
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Diuretic hormone class 2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007589 body fluid secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Length:  31
  • Propeptide:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Signal peptide:  NA
  • Modification:  T31 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion
  • Mechanism:  Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a nonselective effect on Na+/K+?ion transport. In vitro, primarily elevates intracellular Ca2+
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85830-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P85830-F1.pdbhor005215_AF2.pdbhor005215_ESM.pdb

Physical Information

Mass: 352369 Formula: C130H207N39O40S
Absent amino acids: CEITVW Common amino acids: G
pI: 9.3 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 12
Hydrophobicity: 13.87 Boman Index: -900
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.26
Instability Index: 3098.39 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  17068263
  • Title:  From the genome to the proteome: uncovering peptides in the Apis brain.