General Information

  • ID:  hor005214
  • Uniprot ID:  P85826
  • Protein name:  Diuretic hormone class 2
  • Gene name:  NA
  • Organism:  Rhodnius prolixus (Triatomid bug)
  • Family:  Diuretic hormone class 2 family
  • Source:  animal
  • Expression:  Detected throughout the central nervous system in fifth instar larvae, particularly in the medial and lateral neurosecretory cells and the dorsal unpaired median neurons of the mesothoracic ganglionic mass. Also detected in nerve processes over the saliva
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rhodnius (genus), Triatominae (subfamily), Reduviidae (family), Reduvioidea (superfamily), Cimicomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007589 body fluid secretion; GO:0008016 regulation of heart contraction; GO:0035810 positive regulation of urine volume; GO:0043134 regulation of hindgut contraction
  • GO CC:  GO:0005576 extracellular region; GO:0030424 axon; GO:0030425 dendrite; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence Information

  • Sequence:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Length:  31
  • Propeptide:  GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
  • Signal peptide:  NA
  • Modification:  T31 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85826-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P85826-F1.pdbhor005214_AF2.pdbhor005214_ESM.pdb

Physical Information

Mass: 352369 Formula: C130H207N39O40S
Absent amino acids: CEITVW Common amino acids: G
pI: 9.3 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 12
Hydrophobicity: 13.87 Boman Index: -900
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.26
Instability Index: 3098.39 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  18203994
  • Title:  Amino acid sequence and biological activity of a calcitonin-like diuretic hormone (DH31) from Rhodnius prolixus.
  • PubMed ID:  19137558
  • Title:  The neuropeptidome of Rhodnius prolixus brain.
  • PubMed ID:  15626502
  • Title:  Presence and activity of a Dippu-DH31-like peptide in the blood-feeding bug, Rhodnius prolixus.