General Information

  • ID:  hor004816
  • Uniprot ID:  C0HKR2
  • Protein name:  Allatostatin-A-8
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  Allatostatin-A-1: Expressed in antennal lobe (AL), corpora cardiaca (CC), corpora allata (CA) and gnathal ganglion (GNG) (at protein level). Expression in AL and GNG detected in most animals, in CC and CA in some animals (at protein level). Allatostatin-A
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LASKFNFGL
  • Length:  9(188-196)
  • Propeptide:  MLSTSLPVCFLVIGAALCAPERMQNDPDPHDSTAQGSDNHSDHIAPLAKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQTNDDQQQIMNNDLDQAALAEFFDQYDDAGYEKRARPYSFGLGKRFADDDTSEEKRARAYDFGLGKRLPLYNFGLGKRARSYNFGLGKRLASKFNFGLGKRERDMHRFSFGLGKRSADDASTEDSDNYFDV
  • Signal peptide:  MLSTSLPVCFLVIGAALC
  • Modification:  T9 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide inhibitors of juvenile hormone synthesis and gut muscle contraction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKR2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004816_AF2.pdbhor004816_ESM.pdb

Physical Information

Mass: 113905 Formula: C48H73N11O12
Absent amino acids: CDEHIMPQRTVWY Common amino acids: FL
pI: 9.7 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: 71.11 Boman Index: 296
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 97.78
Instability Index: -781.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  29466015
  • Title:  Mating-induced differential peptidomics of neuropeptides and protein hormones in Agrotis ipsilon moths.