General Information

  • ID:  hor004812
  • Uniprot ID:  C0HKR2
  • Protein name:  Allatostatin-A-4
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  Allatostatin-A-1: Expressed in antennal lobe (AL), corpora cardiaca (CC), corpora allata (CA) and gnathal ganglion (GNG) (at protein level). Expression in AL and GNG detected in most animals, in CC and CA in some animals (at protein level). Allatostatin-A
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ARPYSFGL
  • Length:  8(133-140)
  • Propeptide:  MLSTSLPVCFLVIGAALCAPERMQNDPDPHDSTAQGSDNHSDHIAPLAKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQTNDDQQQIMNNDLDQAALAEFFDQYDDAGYEKRARPYSFGLGKRFADDDTSEEKRARAYDFGLGKRLPLYNFGLGKRARSYNFGLGKRLASKFNFGLGKRERDMHRFSFGLGKRSADDASTEDSDNYFDV
  • Signal peptide:  MLSTSLPVCFLVIGAALC
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide inhibitors of juvenile hormone synthesis and gut muscle contraction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  16.5 minutes; /990 seconds ( PubMed ID: 17408666 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKR2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004812_AF2.pdbhor004812_ESM.pdb

Physical Information

Mass: 103507 Formula: C43H63N11O11
Absent amino acids: CDEHIKMNQTVW Common amino acids: AFGLPRSY
pI: 9.35 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -2.5 Boman Index: -781
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 61.25
Instability Index: 3282.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  29466015##17408666
  • Title:  Mating-induced differential peptidomics of neuropeptides and protein hormones in Agrotis ipsilon moths.