General Information

  • ID:  hor004802
  • Uniprot ID:  C4PLD1
  • Protein name:  Amolopkinins W2
  • Gene name:  kininogen
  • Organism:  Amolops wuyiensis (Wuyi torrent frog) (Staurois wuyiensis)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Amolops (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RAALPPGFTPFR
  • Length:  12
  • Propeptide:  MFTSKKSILLLFFLGAISLSLCEEERDADEDETVGEAIAENVKRAALPPGFTPFRVAPEIV
  • Signal peptide:  MFTSKKSILLLFFLGAISLSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Antagonize the contractile effects of canonical bradykinin on isolated rat ileum smooth muscle preparations.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C4PLD1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004802_AF2.pdbhor004802_ESM.pdb

Physical Information

Mass: 152594 Formula: C63H96N18O14
Absent amino acids: CDEHIKMNQSVWY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -15.83 Boman Index: -1697
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 49.17
Instability Index: 5731.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19428766
  • Title:  Amolopkinins W1 and W2--novel bradykinin-related peptides (BRPs) from the skin of the Chinese torrent frog, Amolops wuyiensis: antagonists of bradykinin-induced smooth muscle contraction of the rat ileum.