General Information

  • ID:  hor004790
  • Uniprot ID:  L0PJV8
  • Protein name:  Thr6-bradykinyl-VD
  • Gene name:  NA
  • Organism:  Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas)
  • Family:  Frog skin active peptide (FSAP) family, Bradykinin-related peptide subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agalychnis (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RPPGFTPFRVD
  • Length:  11
  • Propeptide:  MSFLKKSLFLVLFLGLVSFSICEEEKRETEEEENEDEMDKESEEKRESPERPPGFTPFRVD
  • Signal peptide:  MSFLKKSLFLVLFLGLVSFSIC
  • Modification:  T3 4-hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Contract bladder, uterus, arteries, ileal smooth muscle
  • Mechanism:  In arterial smooth muscle and uterus,it acts via B2 receptors.?In ileum, it acts predominantly through B2?receptors but also significantly through B1?receptors
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: Caudal arterial smooth muscle:10.8+/-3.3nM;uterus smooth muscle:1.2+/-0.4*10(-6)M;ileum smooth muscle:645+/-12nM;urinary bladder:1.1+/-0.3*10(-6)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-L0PJV8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004790_AF2.pdbhor004790_ESM.pdb

Physical Information

Mass: 146700 Formula: C60H89N17O15
Absent amino acids: ACEHIKLMNQSWY Common amino acids: P
pI: 10.4 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -78.18 Boman Index: -3019
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 26.36
Instability Index: 4795.45 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  24394432
  • Title:  Bradykinin-related peptides (BRPs) from skin secretions of three genera of phyllomedusine leaf frogs and their comparative pharmacological effects on mammalian smooth muscles.