General Information

  • ID:  hor004779
  • Uniprot ID:  P86093
  • Protein name:  Ranakinin-MS1
  • Gene name:  NA
  • Organism:  Sylvirana nigrovittata (Black-striped frog) (Hylarana nigrovittata)
  • Family:  Bradykinin family
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sylvirana (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0042311 vasodilation; GO:0045933 positive regulation of muscle contraction; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0050832 defense response to fungus; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RAEAVPPGFTPFR
  • Length:  13(44-56)
  • Propeptide:  MFTMKKSLLLLFFLGTISMSLCEEKRDADEEETEGEAKMEDIKRAEAVPPGFTPFRKP
  • Signal peptide:  MFTMKKSLLLLFFLGTISMSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have a contractive effect on the smooth muscle of rat ileum.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P86093-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004779_AF2.pdbhor004779_ESM.pdb

Physical Information

Mass: 165886 Formula: C67H101N19O17
Absent amino acids: CDHIKLMNQSWY Common amino acids: P
pI: 10.4 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -38.46 Boman Index: -2466
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 37.69
Instability Index: 5367.69 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  30008150
  • Title:  Identification and Functional Analysis of Novel Bradykinin-Related Peptides (BRPs) From Skin Secretions of Five Asian Frogs