General Information

  • ID:  hor004774
  • Uniprot ID:  NA
  • Protein name:  RVA-Thr6-Bradykinin(RVA-Thr6-BK)
  • Gene name:  NA
  • Organism:  Odorrana hejiangensis
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  MFTLKKSLLLLFFLGMVSLSLCEQERDADEDDNAGEAKVENVKR​VARPPGFTPFRVAPEIV
  • Length:  62
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  An antagonist of BK actions on rat ileum smooth muscle;cause potent contraction of rat ileum preparations
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: Bladder:7102.00nM;Uterus:817.20nM;Ileum:93.70nM;Tail artery:8.28nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004774_AF2.pdbhor004774_ESM.pdb

Physical Information

Mass: 791016 Formula: C307H490N80O89S3
Absent amino acids: HWY Common amino acids: L
pI: 4.65 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 25
Hydrophobicity: -1.77 Boman Index: -9051
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 92.74
Instability Index: 3527.1 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  31261655
  • Title:  A Novel Bradykinin-Related Peptide, RVA-Thr6-BK, from the Skin Secretion of the Hejiang Frog; Ordorrana hejiangensis: Effects of Mammalian Isolated Smooth Muscle