General Information

  • ID:  hor004760
  • Uniprot ID:  Q9FIA9
  • Protein name:  Elicitor peptide 4
  • Gene name:  PEP4
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Brassicaceae elicitor peptide family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0009753 response to jasmonic acid; GO:0045087 innate immune response
  • GO CC:  NA

Sequence Information

  • Sequence:  GLPGKKNVLKKSRESSGKPGGTNKKPF
  • Length:  27
  • Propeptide:  MERGVSYYLWIPFKFIHQTFGSLLLKLLGLRSPSDHSFPEDGEEEVKVVEVSSRGLPGKKNVLKKSRESSGKPGGTNKKPF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Elicitor of plant defense.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9FIA9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004760_AF2.pdbhor004760_ESM.pdb

Physical Information

Mass: 330423 Formula: C125H215N39O36
Absent amino acids: ACDHIMQWY Common amino acids: K
pI: 11.53 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 4
Hydrophobicity: -139.26 Boman Index: -6507
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39.63
Instability Index: 3490.74 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA