General Information

  • ID:  hor004753
  • Uniprot ID:  Q9LUH9
  • Protein name:  CHALLAH-LIKE1
  • Gene name:  EPFL5
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  Expressed asymetically in the hypocotyl, on the side proximal to the folded cotyledons at germination. Detected in developing flowers, the chalazal region of ovules and near the root apex, but not in inflorescence stems. Expressed in cotyledons, flowers,
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP
  • Length:  51(57-107)
  • Propeptide:  MGVVLPTLIVYAFLLFFSSSSAASLQRPSGGLGQGKKEIARSGLPGQIVDQKRLGGPGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP
  • Signal peptide:  MGVVLPTLIVYAFLLFFSSSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Controls stomatal patterning. Mediates differentiation of stomatal lineage cells to pavement cells and stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL1 signaling. Acts as growth-regulatory ligand for ERECTA family recepto
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TMM
  • Target Unid:  Q9SSD1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-42; 12-18; 15-44
  • Structure ID:  AF-Q9LUH9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004753_AF2.pdbhor004753_ESM.pdb

Physical Information

Mass: 661001 Formula: C256H405N67O63S9
Absent amino acids: DT Common amino acids: P
pI: 8.62 Basic residues: 8
Polar residues: 14 Hydrophobic residues: 13
Hydrophobicity: -10.98 Boman Index: -2948
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 66.86
Instability Index: 4919.22 Extinction Coefficient cystines: 8855
Absorbance 280nm: 177.1

Literature

  • PubMed ID:  22027592
  • Title:  The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Hormones
  • PubMed ID:  21862708
  • Title:   Generation of Signaling Specificity in Arabidopsis by Spatially Restricted Buffering of Ligand-Receptor Interactions
  • PubMed ID:  23748792
  • Title:   EPIDERMAL PATTERNING FACTOR