HORDB

ID: hor004752
Uniprot ID: Q9LUH9
Protein name: EPIDERMAL PATTERNING FACTOR-like protein 5
Gene name: EPFL5
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Source: Plant
Expression: Expressed asymetically in the hypocotyl, on the side proximal to the folded cotyledons at germination. Detected in developing flowers, the chalazal region of ovules and near the root apex, but not in inflorescence stems. Expressed in cotyledons, flowers,
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
GO CC: GO:0005576 extracellular region

Sequence: ASLQRPSGGLGQGKKEIARSGLPGQIVDQKRLGGPGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP
Length: 85
Propeptide: MGVVLPTLIVYAFLLFFSSSSAASLQRPSGGLGQGKKEIARSGLPGQIVDQKRLGGPGSVPPMCRLKCGKCEPCKAVHVPIQPGLIMPLEYYPEAWRCKCGNKLFMP
Signal peptide: MGVVLPTLIVYAFLLFFSSSSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Controls stomatal patterning. Mediates differentiation of stomatal lineage cells to pavement cells and stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL1 signaling. Acts as growth-regulatory ligand for ERECTA family receptors. Promotes fruit growth and fertility.
Mechanism: NA
Cross BBB: NA
Target: TMM
Target Unid: Q9SSD1
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004752_AF2.pdb

hor004752_ESM.pdb

Mass:	1065842	Formula:	C403H659N117O108S9
Absent amino acids:	T	Common amino acids:	GP
pI:	9.78	Basic residues:	14
Polar residues:	25	Hydrophobic residues:	22
Hydrophobicity:	-33.65	Boman Index:	-9408
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	73.41
Instability Index:	5455.65	Extinction Coefficient cystines:	8855
Absorbance 280nm:	105.42

PubMed ID: 22027592
Title: The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Hormones
PubMed ID: 21862708
Title: Generation of Signaling Specificity in Arabidopsis by Spatially Restricted Buffering of Ligand-Receptor Interactions
PubMed ID: 23748792
Title: EPIDERMAL PATTERNING FACTOR LIKE5 Peptide Represses Stomatal Development by Inhibiting Meristemoid Maintenance in Arabidopsis Thaliana