HORDB

ID: hor004750
Uniprot ID: Q2V3I3
Protein name: CHALLAH-LIKE2
Gene name: EPFL4
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Source: Plant
Expression: Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting, in inflorescence stems and in young siliques.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
GO CC: GO:0005576 extracellular region

Sequence: PGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
Length: 51
Propeptide: MGTFRRRRRFLLAALVTFALLHLFSASSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
Signal peptide: MGTFRRRRRFLLAALVTFALLHLFSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal development inhibition. TMM (AC Q9SSD1) functions to dampen or block CLL2 signaling.
Mechanism: NA
Cross BBB: NA
Target: TMM
Target Unid: Q9SSD1
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004750_AF2.pdb

hor004750_ESM.pdb

Mass:	654073	Formula:	C249H390N68O66S8
Absent amino acids:	D	Common amino acids:	P
pI:	8.86	Basic residues:	8
Polar residues:	18	Hydrophobic residues:	9
Hydrophobicity:	-51.96	Boman Index:	-5902
Half-Life:	>20 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	?	Aliphatic Index	43.92
Instability Index:	7038.63	Extinction Coefficient cystines:	8855
Absorbance 280nm:	177.1

PubMed ID: 19435754
Title: Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.
PubMed ID: 22027592
Title: The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones.
PubMed ID: 21862708
Title: Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.
PubMed ID: 22474391
Title: Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.
PubMed ID: 23881395
Title: Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.