General Information

  • ID:  hor004749
  • Uniprot ID:  Q8S8I4
  • Protein name:  MEPF1
  • Gene name:  EPF1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  Not induced by high CO(2). |Expressed in shoots, but not in roots. Mostly localized in developing leaves, specifically in meristemoids, guard mother cells (GMCs), and young guard cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010374 stomatal complex development; GO:0010375 stomatal complex patterning; GO:2000122 negative regulation of stomatal complex development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP
  • Length:  52
  • Propeptide:  MKSLLLLAFFLSFFFGSLLARHLPTSSHPSHHHVGMTGALKRQRRRPDTVQVAGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP
  • Signal peptide:  MKSLLLLAFFLSFFFGSLLA
  • Modification:  NA
  • Glycosylation:  T46 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1).mobile signal controlling stomatal development in a non-cell-autonomous manner. Uses ERL1 as major receptor. May act by competing with somatogen (AC Q9SV72) for the same receptor, TMM (AC Q9SSD1).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-42; 12-18; 15-44; 27-36
  • Structure ID:  AF-Q8S8I4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004749_AF2.pdbhor004749_ESM.pdb

Physical Information

Mass: 644431 Formula: C229H364N64O73S11
Absent amino acids: IQW Common amino acids: CS
pI: 6.97 Basic residues: 5
Polar residues: 22 Hydrophobic residues: 13
Hydrophobicity: 14.23 Boman Index: -5344
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52.5
Instability Index: 6898.46 Extinction Coefficient cystines: 3480
Absorbance 280nm: 68.24

Literature

  • PubMed ID:  17639078
  • Title:  The Secretory Peptide Gene EPF1 Enforces the Stomatal One-Cell-Spacing Rule
  • PubMed ID:  22241782
  • Title:   Direct Interaction of Ligand-Receptor Pairs Specifying Stomatal Patterning
  • PubMed ID:  22027592
  • Title:   The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Hormones