General Information

  • ID:  hor004748
  • Uniprot ID:  Q8LC53
  • Protein name:  MEPF2
  • Gene name:  EPF2
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  Induced by high CO(2). |Expressed in leaves, especially by the MMCs and their early descendants cells (stomatal lineage cells) including guard mother cells (GMCs).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0019901 protein kinase binding
  • GO BP:  GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development; GO:0090626 plant epidermis morphogenesis; GO:2000122 negative regulation of stomatal complex development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA
  • Length:  52(69-120)
  • Propeptide:  MTKFVRKYMFCLVLVFAACSLVVNSIRTPPLKNTVNGGEKKNADIEQAQTHHKKEISKNGGVEMEMYPTGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA
  • Signal peptide:  MTKFVRKYMFCLVLVFAACSLVVNS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  1-12TGSSLPDCSYAC->IGSTAPTCTYNE: Loss of cleavage by CRSP.

Activity

  • Function:  Controls stomatal patterning. Regulates the number of cells that enter, and remain in, the stomatal lineage by inhibiting protodermal cells from adopting the meristemoid mother cell (MMC) fate in a non-cell-autonomous manner. Mediates stomatal development
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TMM
  • Target Unid:  Q9SSD1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-39; 12-18; 15-41; 27-33
  • Structure ID:  AF-Q8LC53-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004748_AF2.pdbhor004748_ESM.pdb

Physical Information

Mass: 657235 Formula: C236H372N70O74S9
Absent amino acids: NQW Common amino acids: SC
pI: 8.2 Basic residues: 7
Polar residues: 26 Hydrophobic residues: 12
Hydrophobicity: 3.08 Boman Index: -8690
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52.5
Instability Index: 8143.85 Extinction Coefficient cystines: 6460
Absorbance 280nm: 126.67

Literature

  • PubMed ID:  19435754
  • Title:  Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.
  • PubMed ID:  19398336
  • Title:  The signaling peptide EPF2 controls asymmetric cell divisions during stomatal development.
  • PubMed ID:  22027592
  • Title:  The NMR Structure of Stomagen Reveals the Ba
  • PubMed ID:  22241782
  • Title: