General Information

  • ID:  hor004740
  • Uniprot ID:  A8MRM1
  • Protein name:  Protein RALF-like 16
  • Gene name:  RALFL16
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RTLGYGSIKGDRIPACGYKNPNSCVKQPVNHYHRGCEKITRCARDAARYTESFNVDDDESPIINLH
  • Length:  66(30-95)
  • Propeptide:  MVAYEKSPIVFLFATMMLVMFLFCGSGEARTLGYGSIKGDRIPACGYKNPNSCVKQPVNHYHRGCEKITRCARDAARYTESFNVDDDESPIINLH
  • Signal peptide:  MVAYEKSPIVFLFATMMLVMFLFCGSGEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  16-24; 36-42
  • Structure ID:  AF-A8MRM1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004740_AF2.pdbhor004740_ESM.pdb

Physical Information

Mass: 861190 Formula: C318H500N100O100S4
Absent amino acids: MW Common amino acids: RDGIN
pI: 8.33 Basic residues: 13
Polar residues: 25 Hydrophobic residues: 15
Hydrophobicity: -86.97 Boman Index: -18374
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 60.61
Instability Index: 4028.64 Extinction Coefficient cystines: 6210
Absorbance 280nm: 95.54

Literature

  • PubMed ID:  12611624
  • Title:  Peptomics, Identification of Novel Cationic Arabidopsis Peptides with Conserved Sequence Motifs.