General Information

  • ID:  hor004722
  • Uniprot ID:  Q1ECR9(29-82)
  • Protein name:  Protein RALF-like 8
  • Gene name:  RALFL8
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  Slightly induced by abscisic acid (ABA) and accumulates during senescence. |Expressed in leaves and flowers.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  SVRYITYPAIDRGDHAVHCDKAHPNTCKKKQANPYRRGCGVLEGCHRETGPKPT
  • Length:  54(29-82)
  • Propeptide:  MGMSKSIKVILSLALVVFLALAGTKVEASVRYITYPAIDRGDHAVHCDKAHPNTCKKKQANPYRRGCGVLEGCHRETGPKPT
  • Signal peptide:  MGMSKSIKVILSLALVVFLALAGTKVEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  19-27; 39-45
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004722_AF2.pdbhor004722_ESM.pdb

Physical Information

Mass: 697938 Formula: C257H409N85O76S4
Absent amino acids: FMW Common amino acids: GKPRACHT
pI: 9.36 Basic residues: 14
Polar residues: 19 Hydrophobic residues: 10
Hydrophobicity: -106.85 Boman Index: -14975
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 45.19
Instability Index: 2244.26 Extinction Coefficient cystines: 4720
Absorbance 280nm: 89.06

Literature

  • PubMed ID:  12611624
  • Title:  Peptomics, Identification of Novel Cationic Arabidopsis Peptides with Conserved Sequence Motifs.