General Information

  • ID:  hor004714
  • Uniprot ID:  Q945T0(67-115)
  • Protein name:  Protein RALF-like 1
  • Gene name:  RALF
  • Organism:  Nicotiana tabacum (Common tobacco)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nicotiana (genus), Nicotianeae (tribe), Nicotianoideae (subfamily), Solanaceae (family), Solanales (order), lamiids, asterids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0010469 regulation of signaling receptor activity; GO:0019722 calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCSAITRCRS
  • Length:  49(67-115)
  • Propeptide:  MGVPSGLILCVLIGAFFISMAAAGDSGAYDWVMPARSGGGCKGSIGECIAEEEEFELDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCSAITRCRS
  • Signal peptide:  MGVPSGLILCVLIGAFFISMAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  18-28; 41-47
  • Structure ID:  AF-Q945T0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004714_AF2.pdbhor004714_ESM.pdb

Physical Information

Mass: 619138 Formula: C226H363N73O69S4
Absent amino acids: DEFHMW Common amino acids: S
pI: 10.31 Basic residues: 9
Polar residues: 25 Hydrophobic residues: 10
Hydrophobicity: -76.94 Boman Index: -11890
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 42.04
Instability Index: 3658.37 Extinction Coefficient cystines: 7700
Absorbance 280nm: 160.42

Literature

  • PubMed ID:  11675511
  • Title:  RALF, a 5-kDa ubiquitous polypeptide in plants, arrests root growth and development.