General Information

  • ID:  hor004709
  • Uniprot ID:  Q6DUW6
  • Protein name:  Protein IDA-LIKE 4
  • Gene name:  IDL4
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  NA
  • Source:  Plant
  • Expression:  Expressed in mainly in buds. Lower levels in roots. Detected at the base of pedicel, in the floral and funicule abscission zones, in vascular tissues, in guard cells of young seedlings and in hydathodes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010227 floral organ abscission
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASRFSSSSVFYRNPNYDHSNNTVRRGHFLGFLPRHLPVPASAPSRKHNDIGIQALLSP
  • Length:  58(36-93)
  • Propeptide:  MYPTRPHYWRRRLSINRPQAFLLLILCLFFIHHCDASRFSSSSVFYRNPNYDHSNNTVRRGHFLGFLPRHLPVPASAPSRKHNDIGIQALLSP
  • Signal peptide:  MYPTRPHYWRRRLSINRPQAFLLLILCLFFIHHCD
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in floral abscission.
  • Mechanism:  IDL4 is only partially redundant with IDA.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004709_AF2.pdbhor004709_ESM.pdb

Physical Information

Mass: 750509 Formula: C289H443N91O81
Absent amino acids: CEMW Common amino acids: S
pI: 11.86 Basic residues: 11
Polar residues: 20 Hydrophobic residues: 18
Hydrophobicity: -58.62 Boman Index: -13480
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 68.97
Instability Index: 7547.07 Extinction Coefficient cystines: 2980
Absorbance 280nm: 52.28

Literature

  • PubMed ID:  12972671
  • Title:  Inflorescence deficient in abscission controls floral organ abscission in Arabidopsis and identifies a novel family of putative ligands in plants.
  • PubMed ID:  18660431
  • Title:  The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsis