General Information

  • ID:  hor004707
  • Uniprot ID:  Q29PV4
  • Protein name:  Protein IDA-LIKE 1
  • Gene name:  IDL1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  NA
  • Source:  Plant
  • Expression:  Expressed in roots.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010227 floral organ abscission
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RIGPIKLSETEIVQTRSRQEIIGGFTFKGRVFHSFSKRVLVPPSGPSMRHNSVVNNLKH
  • Length:  59(28-86)
  • Propeptide:  MNLSHKTMFMTLYIVFLLIFGSYNATARIGPIKLSETEIVQTRSRQEIIGGFTFKGRVFHSFSKRVLVPPSGPSMRHNSVVNNLKH
  • Signal peptide:  MNLSHKTMFMTLYIVFLLIFGSYNATA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in an ethylene-independent separation step of floral abscission.
  • Mechanism:  IDL1 is redundant with IDA.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q29PV4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004707_AF2.pdbhor004707_ESM.pdb

Physical Information

Mass: 770640 Formula: C297H484N92O81S
Absent amino acids: ACDWY Common amino acids: SRV
pI: 12.24 Basic residues: 13
Polar residues: 18 Hydrophobic residues: 18
Hydrophobicity: -40.85 Boman Index: -12607
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 82.37
Instability Index: 5900 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12972671
  • Title:  Inflorescence deficient in abscission controls floral organ abscission in Arabidopsis and identifies a novel family of putative ligands in plants.
  • PubMed ID:  18660431
  • Title:  The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsis