HORDB

ID: hor004705
Uniprot ID: Q8LAD7
Protein name: Protein IDA
Gene name: IDA
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: NA
Source: Plant
Expression: By wounding. |Expressed only during floral abscission. |Expressed specifically in the floral abscission zone.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding
GO BP: GO:0009723 response to ethylene; GO:0010102 lateral root morphogenesis; GO:0010227 floral organ abscission; GO:0010468 regulation of gene expression; GO:0045490 pectin catabolic process; GO:0050829 defense response to Gram-negative bacterium; GO:0060305 regulation of cell diameter; GO:0060866 leaf abscission
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: ARIGATMEMKKNIKRLTFKNSHIFGYLPKGVPIPPSAPSKRHNSFVNSLPH
Length: 51(27-77)
Propeptide: MAPCRTMMVLLCFVLFLAASSSCVAAARIGATMEMKKNIKRLTFKNSHIFGYLPKGVPIPPSAPSKRHNSFVNSLPH
Signal peptide: MAPCRTMMVLLCFVLFLAASSSCVAA
Modification: NA
Glycosylation: NA
Mutagenesis: 40-41KR->AA: Reduced activity leading to delayed floral abscission.; 40-40KR->AA: Reduced activity leading to delayed floral abscission.

Function: Involved in an ethylene-independent separation step of floral abscission. Promotes abscission zone (AZ) cells rounding.
Mechanism: IDL1 is capable of replacing the activity of IDA while IDL2, IDL3, IDL4 and IDL5 are only partially redundant.IDA is processed in vitro by the same proteolytic activity releasing the CLE peptide from CLV3.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004705_AF2.pdb

hor004705_ESM.pdb

Mass:	660673	Formula:	C259H416N76O66S2
Absent amino acids:	CDQW	Common amino acids:	KPS
pI:	11.83	Basic residues:	12
Polar residues:	15	Hydrophobic residues:	15
Hydrophobicity:	-51.18	Boman Index:	-8328
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70.78
Instability Index:	6639.41	Extinction Coefficient cystines:	1490
Absorbance 280nm:	29.8

PubMed ID: 12972671
Title: Inflorescence deficient in abscission controls floral organ abscission in Arabidopsis and identifies a novel family of putative ligands in plants.
PubMed ID: 18660431
Title: The EPIP peptide of INFLORESCENCE DEFICIENT IN ABSCISSION is sufficient to induce abscission in arabidopsis
PubMed ID: 23963677
Title:
PubMed ID: 27058169
Title: