General Information

  • ID:  hor004704
  • Uniprot ID:  B3H5A9
  • Protein name:  C-terminally encoded peptide 6.2
  • Gene name:  CEP6
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  C-terminally encoded plant signaling peptide (CEP) family
  • Source:  Plant
  • Expression:  Triggered by nitrogen depletion. |Expressed in lateral root primordia and in lateral roots excluding the meristem region. Also present in the aerial tissues, such as leaf petioles and the shoot apex region.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006995 cellular response to nitrogen starvation; GO:0007165 signal transduction; GO:0015698 inorganic anion transport; GO:0048364 root development; GO:1901371 regulation of leaf morphogenesis; GO:1902025 nitrate import; GO:2000280 regulation of root development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  DFEPTTPGHSPGVGH
  • Length:  15
  • Propeptide:  MKLSVYIILSILFISTVFYEIQFTEARQLRKTDDQDHDDHHFTVGYTDDFGPTSPGNSPGIGHKMKENEENAGGYKDDFEPTTPGHSPGVGHAVKNNEPNA
  • Signal peptide:  MKLSVYIILSILFISTVFYEIQFTEA
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline;T11 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signaling peptide that represses primary root growth rate. Modulates leaf morphology (PubMed:24179096). Regulates systemic nitrogen (N)-demand signaling. Mediates up-regulation of genes involved in N uptake and assimilation pathways (PubMed:25324386). {ECO:0000269|PubMed:24179096, ECO:0000269|PubMed:25324386}.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B3H5A9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004704_AF2.pdbhor004704_ESM.pdb

Physical Information

Mass: 178449 Formula: C67H95N19O23
Absent amino acids: ACIKLMNQRWY Common amino acids: GP
pI: 5.3 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -97.33 Boman Index: -2355
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 19.33
Instability Index: 4078 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  24179096
  • Title:  CEP genes regulate root and shoot development in response to environmental cues and are specific to seed plants.
  • PubMed ID:  25324386
  • Title:  Perception of root-derived peptides by shoot LRR-RKs mediates systemic N-demand signaling.