General Information

  • ID:  hor004702
  • Uniprot ID:  Q058G9
  • Protein name:  C-terminally encoded peptide 5
  • Gene name:  CEP5
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  C-terminally encoded plant signaling peptide (CEP) family
  • Source:  Plant
  • Expression:  Induced by gibberellic acid (GA) and phosphorus (P), but repressed by brassinosteroids (BR), salicylic acid (SA) and nitrogen (N) . |Mostly expressed in roots, and, at lower levels, in stems, leaves and flowers .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0006970 response to osmotic stress; GO:0006995 cellular response to nitrogen starvation; GO:0007165 signal transduction; GO:0009630 gravitropism; GO:0009733 response to auxin; GO:0009739 response to gibberellin; GO:0009741 response to brassinosteroid; GO:0009751 response to salicylic acid; GO:0010311 lateral root formation; GO:0015698 inorganic anion transport; GO:0048364 root development; GO:0060359 response to ammonium ion; GO:0080022 primary root development; GO:0090548 response to nitrate starvation
  • GO CC:  NA

Sequence Information

  • Sequence:  DFRPTTPGHSPGIGH
  • Length:  15(86-100)
  • Propeptide:  MESFMGQKKTLYACYFLMLVFFLGFNCVHGRTLKVDDKINGGHYDSKTMMALAKHNDMMVDDKAMQFSPPPPPPPPSQSGGKDAEDFRPTTPGHSPGIGHSLSHN
  • Signal peptide:  MESFMGQKKTLYACYFLMLVFFLGFNCVHG
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline;T11 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  3-14RPTTPGHSPGIG->LPHTPGHVPGIS: Impaired repression of root growth and lateral root initiation.

Activity

  • Function:  Extracellular signaling peptide that represses plant growth rate. Regulates shoot gravitropic responses . Represses primary root length and lateral root initiation, probably by repressing the CEP receptor CEPR1. Regulates systemic nitrogen (N)-demand sign
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  XIP1
  • Target Unid:   Q9FGL5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q058G9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004702_AF2.pdbhor004702_ESM.pdb

Physical Information

Mass: 182559 Formula: C69H102N22O21
Absent amino acids: ACEKLMNQVWY Common amino acids: GP
pI: 7.71 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -102 Boman Index: -3078
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 26
Instability Index: 4078 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18315543
  • Title:  Identification of a biologically active, small, secreted peptide in Arabidopsis by in silico gene screening, followed by LC-MS-based structure analysis.
  • PubMed ID:  24179095
  • Title:  The CEP family in land plants: evolutionary analyses, expression studies, and role in Arabidopsis sho
  • PubMed ID:  24179096
  • Title:  
  • PubMed ID:  25324386
  • Title:  
  • PubMed ID:  27296247
  • Title: