General Information

  • ID:  hor004701
  • Uniprot ID:  Q8L8Y3
  • Protein name:  C-terminally encoded peptide 1
  • Gene name:  CEP1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  C-terminally encoded plant signaling peptide (CEP) family
  • Source:  Plant
  • Expression:  Induced by auxin and nitrogen (N) . |In young seedlings, only observed in lateral root primordia, first in the core region at stage VI, in which cells of outer layer 2 undergo a periclinal division, creating a new internal layer . |Mainly expressed in the
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0006970 response to osmotic stress; GO:0006995 cellular response to nitrogen starvation; GO:0007166 cell surface receptor signaling pathway; GO:0009651 response to salt stress; GO:0009733 response to auxin; GO:0015698 inorganic anion transport; GO:0030308 negative regulation of cell growth; GO:0048364 root development; GO:0048527 lateral root development; GO:0048573 photoperiodism, flowering; GO:0051782 negative regulation of cell division; GO:0071242 cellular response to ammonium ion; GO:0090548 response to nitrate starvation; GO:1901698 response to nitrogen compound; GO:1902025 nitrate import; GO:2000280 regulation of root development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048046 apoplast

Sequence Information

  • Sequence:  DFRPTNPGNSPGVGH
  • Length:  15
  • Propeptide:  MGMSNRSVSTSIFFLALVVLHGIQDTEERHLKTTSLEIEGIYKKTEAEHPSIVVTYTRRGVLQKEVIAHPTDFRPTNPGNSPGVGHSNGRH
  • Signal peptide:  MGMSNRSVSTSIFFLALVVLHGIQDTEE
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline;T11 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signaling peptide that represses, in a dose-dependent manner, primary root growth rate and lateral root elongation by inhibiting both cell division in meristems and cell growth in elongation zones. Prevents also slightly growth of above-ground parts. Regulates systemic nitrogen (N)-demand signaling. Mediates systemic up-regulation of genes involved in N uptake and assimilation pathways (e.g. NRT1.1, NRT2.1 and NRT3.1).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8L8Y3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004701_AF2.pdbhor004701_ESM.pdb

Physical Information

Mass: 180152 Formula: C66H98N22O22
Absent amino acids: ACEIKLMQWY Common amino acids: GP
pI: 7.55 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 2
Hydrophobicity: -124.67 Boman Index: -3771
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 19.33
Instability Index: 2258 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18315543
  • Title:  Identification of a biologically active, small, secreted peptide in Arabidopsis by in silico gene screening, followed by LC-MS-based structure analysis.
  • PubMed ID:  24179095
  • Title:   The CEP family in land plants: evolutionary analyses, expression studies, and role in Arabidopsis shoot development.
  • PubMed ID:  25324386
  • Title:  Perception of root-derived peptides by shoot LRR-RKs mediates systemic N-demand signaling.