General Information

  • ID:  hor004700
  • Uniprot ID:  O80460
  • Protein name:  C-terminally encoded peptide 3
  • Gene name:  CEP3
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  C-terminally encoded plant signaling peptide (CEP) family
  • Source:  Plant
  • Expression:  Induced by auxin, but repressed by potassium (K) and nitrogen (N) . |Mostly expressed in roots .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0006970 response to osmotic stress; GO:0006995 cellular response to nitrogen starvation; GO:0007165 signal transduction; GO:0009266 response to temperature stimulus; GO:0009642 response to light intensity; GO:0009651 response to salt stress; GO:0009733 response to auxin; GO:0009744 response to sucrose; GO:0010037 response to carbon dioxide; GO:0035864 response to potassium ion; GO:0048364 root development; GO:0048831 regulation of shoot system development; GO:0090548 response to nitrate starvation; GO:1901371 regulation of leaf morphogenesis; GO:1901698 response to nitrogen compound; GO:1902025 nitrate import; GO:2000023 regulation of lateral root development
  • GO CC:  NA

Sequence Information

  • Sequence:  TFRPTEPGHSPGIGH
  • Length:  15
  • Propeptide:  MATINVYVFAFIFLLTISVGSIEGRKLTKFTVTTSEEIRAGGSVLSSSPPTEPLESPPSHGVDTFRPTEPGHSPGIGHSVHN
  • Signal peptide:  MATINVYVFAFIFLLTISVGSIEG
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline;T11 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signaling peptide that represses primary root growth rate and significantly inhibits lateral root formation. Promotes shoot growth. Modulates leaf morphology. Regulates systemic nitrogen (N)-demand signaling. Mediates systemic up-regulation of genes involved in N uptake and assimilation pathways.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O80460-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004700_AF2.pdbhor004700_ESM.pdb

Physical Information

Mass: 183961 Formula: C70H104N22O21
Absent amino acids: ACDKLMNQVWY Common amino acids: GP
pI: 7.71 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -102 Boman Index: -2887
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 26
Instability Index: 7971.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18315543
  • Title:  Identification of a biologically active, small, secreted peptide in Arabidopsis by in silico gene screening, followed by LC-MS-based structure analysis.
  • PubMed ID:  24179095
  • Title:  The CEP family in land plants: evolutionary analyses, expression studies, and role in Arabidopsis shoot development.
  • PubMed ID:  24179096
  • Title:  CEP genes regulate root and shoot development in response to environmental cues and are specific to seed plants.
  • PubMed ID:  25324386
  • Title:   Perception of root-derived peptides by shoot LRR-RKs mediates systemic N-demand signaling.