General Information

  • ID:  hor004683
  • Uniprot ID:  Q0DAS9
  • Protein name:  Phytosulfokines 1
  • Gene name:  PSK1
  • Organism:  Oryza sativa subsp. japonica (Rice)
  • Family:  Phytosulfokine family
  • Source:  Plant
  • Expression:  Expressed throughout the seedling. More abundant in fragments containing shoot or root apexes where cells proliferate vigorously.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryza sativa (species), Oryza (genus), Oryzinae (subtribe), Oryzeae (tribe), Oryzoideae (subfamily), BOP clade, Poaceae (family), Poales (order), commelinids, Petrosaviidae (subclass), Liliopsida, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YIYTQ
  • Length:  5(80-84)
  • Propeptide:  MVNPGRTARALCLLCLALLLLGQDTHSRKLLLQEKHSHGVGNGTTTTQEPSRENGGSTGSNNNGQLQFDSAKWEEFHTDYIYTQDVKKP
  • Signal peptide:  MVNPGRTARALCLLCLALLLLG
  • Modification:  T1 Sulfotyrosine;T3 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.
  • Mechanism:  The N-terminal tripeptide (YIY) is the active core.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q0DAS9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004683_AF2.pdbhor004683_ESM.pdb

Physical Information

Mass: 75829 Formula: C33H46N6O10
Absent amino acids: ACDEFGHKLMNPRSVW Common amino acids: Y
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: -46 Boman Index: -347
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: -2406 Extinction Coefficient cystines: 2980
Absorbance 280nm: 745

Literature

  • PubMed ID:  NA
  • Title:  NA