HORDB

ID: hor004675
Uniprot ID: Q6DSU1
Protein name: Root meristem growth factor 2
Gene name: GLV5
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: RGF family
Source: Plant
Expression: Accumulates in both root epidermis and cortex after Pi- deprivation. |In roots, expressed only in the quiescent center (QC), the columella stem cells (CC) and the innermost layer of central columella cells; mostly present in the second, third and fourth C
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005515 protein binding; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0009786 regulation of asymmetric cell division; GO:0010082 regulation of root meristem growth; GO:0016036 cellular response to phosphate starvation; GO:0030154 cell differentiation; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis; GO:2000280 regulation of root development
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DYWKPRHHPPKNN
Length: 13
Propeptide: MTNITSSFLCLLILLLFCLSFGYSLHGDKDEVLSVDVGSNAKVMKHLDGDDAMKKAQVRGRSGQEFSKETTKMMMKKTTKKETNVEEEDDLVAYTADYWKPRHHPPKNN
Signal peptide: MTNITSSFLCLLILLLFCLSFGYS
Modification: T2 Sulfotyrosine;T10 Hydroxyproline
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004675_AF2.pdb

hor004675_ESM.pdb

Mass:	190308	Formula:	C77H109N25O19
Absent amino acids:	ACEFGILMQSTV	Common amino acids:	P
pI:	10.24	Basic residues:	5
Polar residues:	3	Hydrophobic residues:	1
Hydrophobicity:	-278.46	Boman Index:	-5515
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	1706.92	Extinction Coefficient cystines:	6990
Absorbance 280nm:	582.5