General Information

  • ID:  hor004666
  • Uniprot ID:  Q06JG6
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 16D10
  • Gene name:  16D10
  • Organism:  Meloidogyne javanica (Root-knot nematode worm)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Animal
  • Expression:  Highly expressed exclusively within the subventral esophageal gland cell during syncytium formation in host plants.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Meloidogyne incognita group, Meloidogyne (genus), Meloidogyninae (subfamily), Meloidogynidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0030430 host cell cytoplasm; GO:0043655 host extracellular space

Sequence Information

  • Sequence:  GKKPSGPNPGGNN
  • Length:  13(31-43)
  • Propeptide:  MFTNSIKNLIIYLMPLMVTLMLLSVSFVDAGKKPSGPNPGGNN
  • Signal peptide:  MFTNSIKNLIIYLMPLMVTLMLLSVSFVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in the differentiation or division of feeding cells (syncytia) induced in plant roots during infection. Promotes host root growth.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q06JG6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004666_AF2.pdbhor004666_ESM.pdb

Physical Information

Mass: 143752 Formula: C50H82N18O18
Absent amino acids: ACDEFHILMQRTVWY Common amino acids: G
pI: 10.81 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 0
Hydrophobicity: -196.15 Boman Index: -3066
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 0
Instability Index: 1246.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA