General Information

  • ID:  hor004664
  • Uniprot ID:  Q8L9H6
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 17
  • Gene name:  CLE17
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE17p]: Mostly expressed in seedlings, roots, flowers, stems and apex, and, to a lower extent, in leaves and siliques.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0048731 system development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  TMCFFLFFFVFYVSFQIVLSSSASVGYSRLHLVASPPPPPPRKALRYSTAPFRGPLSRDDIYGDDKRVVHTGPNPLHN
  • Length:  78(22-99)
  • Propeptide:  MTHVLVRRQGQGKKRRWDVNMTMCFFLFFFVFYVSFQIVLSSSASVGYSRLHLVASPPPPPPRKALRYSTAPFRGPLSRDDIYGDDKRVVHTGPNPLHN
  • Signal peptide:  MTHVLVRRQGQGKKRRWDVNM
  • Modification:  T73 Hydroxyproline
  • Glycosylation:  T73 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8L9H6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004664_AF2.pdbhor004664_ESM.pdb

Physical Information

Mass: 1016068 Formula: C409H611N107O106S2
Absent amino acids: EW Common amino acids: PS
pI: 10 Basic residues: 11
Polar residues: 23 Hydrophobic residues: 28
Hydrophobicity: -2.56 Boman Index: -9614
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 76.15
Instability Index: 4564.23 Extinction Coefficient cystines: 5960
Absorbance 280nm: 77.4

Literature

  • PubMed ID:  30114285
  • Title:  The Signaling Peptide-Encoding Genes CLE16, CLE17 and CLE27 Are Dispensable for Arabidopsis Shoot Apical Meristem Activity