HORDB

ID: hor004638
Uniprot ID: Q8LFL4
Protein name: CLAVATA3/ESR (CLE)-related protein 25 [Cleaved into: CLE25p]
Gene name: CLE25
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE25p]: Mostly expressed in flowers and siliques, and, to a lower extent, in roots, stems, apex, seedlings, leaves and pollen.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0010116 positive regulation of abscisic acid biosynthetic process; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:1902584 positive regulation of response to water deprivation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: APSVPSSENVKTLRFSGKDVNLFHVSKRKVPNGPDPIHNRKAETSRRPPRV
Length: 51(31-81)
Propeptide: MGGNGIRALVGVIASLGLIVFLLVGILANSAPSVPSSENVKTLRFSGKDVNLFHVSKRKVPNGPDPIHNRKAETSRRPPRV
Signal peptide: MGGNGIRALVGVIASLGLIVFLLVGILANS
Modification: T31 Hydroxyproline;T34 Hydroxyproline
Glycosylation: T34 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004638_AF2.pdb

hor004638_ESM.pdb

Mass:	659646	Formula:	C249H410N82O72
Absent amino acids:	CMQWY	Common amino acids:	PRSV
pI:	11.95	Basic residues:	13
Polar residues:	14	Hydrophobic residues:	13
Hydrophobicity:	-103.14	Boman Index:	-15929
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	60.98
Instability Index:	6623.33	Extinction Coefficient cystines:	0
Absorbance 280nm:	0