HORDB

ID: hor004635
Uniprot ID: Q8W261
Protein name: CLAVATA3/ESR (CLE)-related protein 19
Gene name: CLE19
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE19p]: Mostly expressed in heart-shape embryos, pollen and young flower buds, and, to a lower extent, in inflorescence, leaves and roots.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0001708 cell fate specification; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: ASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSALDSKRVIPTGPNPLHNR
Length: 50
Propeptide: MKIKGLMILASSLLILAFIHQSESASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSALDSKRVIPTGPNPLHNR
Signal peptide: MKIKGLMILASSLLILAFIHQSES
Modification: T41 Hydroxyproline;T44 Hydroxyproline
Glycosylation: T10 N-linked (GlcNAc...) asparagine;T30 N-linked (GlcNAc...) asparagine;T44 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004635_AF2.pdb

hor004635_ESM.pdb

Mass:	639733	Formula:	C233H379N69O80S3
Absent amino acids:	CFW	Common amino acids:	S
pI:	5.7	Basic residues:	6
Polar residues:	19	Hydrophobic residues:	12
Hydrophobicity:	-69.2	Boman Index:	-11534
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	72.2
Instability Index:	5559.2	Extinction Coefficient cystines:	2980
Absorbance 280nm:	60.82