General Information

  • ID:  hor004635
  • Uniprot ID:  Q8W261
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 19
  • Gene name:  CLE19
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE19p]: Mostly expressed in heart-shape embryos, pollen and young flower buds, and, to a lower extent, in inflorescence, leaves and roots.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0001708 cell fate specification; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  ASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSALDSKRVIPTGPNPLHNR
  • Length:  50
  • Propeptide:  MKIKGLMILASSLLILAFIHQSESASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSALDSKRVIPTGPNPLHNR
  • Signal peptide:  MKIKGLMILASSLLILAFIHQSES
  • Modification:  T41 Hydroxyproline;T44 Hydroxyproline
  • Glycosylation:  T10 N-linked (GlcNAc...) asparagine;T30 N-linked (GlcNAc...) asparagine;T44 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8W261-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004635_AF2.pdbhor004635_ESM.pdb

Physical Information

Mass: 639733 Formula: C233H379N69O80S3
Absent amino acids: CFW Common amino acids: S
pI: 5.7 Basic residues: 6
Polar residues: 19 Hydrophobic residues: 12
Hydrophobicity: -69.2 Boman Index: -11534
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 72.2
Instability Index: 5559.2 Extinction Coefficient cystines: 2980
Absorbance 280nm: 60.82

Literature

  • PubMed ID:  NA
  • Title:  NA