General Information

  • ID:  hor004634
  • Uniprot ID:  Q8W261
  • Protein name:  CLE19p
  • Gene name:  CLE19
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE19p]: Mostly expressed in heart-shape embryos, pollen and young flower buds, and, to a lower extent, in inflorescence, leaves and roots.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0001708 cell fate specification; GO:0010082 regulation of root meristem growth; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  KRVIPTGPNPLHNR
  • Length:  14
  • Propeptide:  MKIKGLMILASSLLILAFIHQSESASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSALDSKRVIPTGPNPLHNR
  • Signal peptide:  MKIKGLMILASSLLILAFIHQSES
  • Modification:  T5 Hydroxyproline;T8 Hydroxyproline
  • Glycosylation:  T8 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Lead to consumption of the root meristem.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8W261-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004634_AF2.pdbhor004634_ESM.pdb

Physical Information

Mass: 183092 Formula: C70H119N25O18
Absent amino acids: ACDEFMQSWY Common amino acids: P
pI: 12.52 Basic residues: 4
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -117.86 Boman Index: -4108
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 76.43
Instability Index: 3930.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16055633
  • Title:  The 14-amino Acid CLV3, CLE19, and CLE40 Peptides Trigger Consumption of the Root Meristem in Arabidopsis Through a CLAVATA2-dependent Pathway