General Information

  • ID:  hor004632
  • Uniprot ID:  Q9LXU0
  • Protein name:  CLE40p
  • Gene name:  CLE40
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE40p]: Expressed in the entire embryo at the globular stage. Progressively restricted to the basal regions of the embryo that form the root meristem and the vasculature. After germination, detected in the differentiation zone of the stele that forms th
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0001708 cell fate specification; GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  ERQVPTGSDPLHHK
  • Length:  14(61-74)
  • Propeptide:  MAAMKYKGSVFIILVILLLSSSLLAHSSSTKSFFWLGETQDTKAMKKEKKIDGGTANEVEERQVPTGSDPLHHKHIPFTP
  • Signal peptide:  MAAMKYKGSVFIILVILLLSSSLLA
  • Modification:  T5 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Lead to consumption of the root meristem.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LXU0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004632_AF2.pdbhor004632_ESM.pdb

Physical Information

Mass: 183281 Formula: C68H109N23O22
Absent amino acids: ACFIMNWY Common amino acids: HP
pI: 7.71 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -160 Boman Index: -4693
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.57
Instability Index: 4226.43 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16055633
  • Title:  The 14-amino Acid CLV3, CLE19, and CLE40 Peptides Trigger Consumption of the Root Meristem in Arabidopsis Through a CLAVATA2-dependent Pathway