HORDB

ID: hor004630
Uniprot ID: Q3ECJ5
Protein name: CLE14p
Gene name: CLE14
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE14p]: Induced by Pi starvation. |[CLE14p]: Expressed specifically in differentiating cells of the root. |[CLE14p]: Mostly expressed in roots, and, to a lower extent, in seedlings and leaves .
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0016036 cellular response to phosphate starvation; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:1900055 regulation of leaf senescence; GO:2000377 regulation of reactive oxygen species metabolic process
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: RLVPKGPNPLHN
Length: 12
Propeptide: MKVWSQRLSFLIVMIFILAGLHSSSAGRKLPSMTTTEEFQRLSFDGKRILSEVTADKKYDRIYGASARLVPKGPNPLHNK
Signal peptide: MKVWSQRLSFLIVMIFILAGLHSSSA
Modification: T4 Hydroxyproline;T7 Hydroxyproline
Glycosylation: T7 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Acts as an elicitor of the root meristem differentiation through the CLV2/CRN complex signaling pathway. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004630_AF2.pdb

hor004630_ESM.pdb

Mass:	153796	Formula:	C60H100N20O15
Absent amino acids:	ACDEFIMQSTWY	Common amino acids:	P
pI:	11.65	Basic residues:	3
Polar residues:	3	Hydrophobic residues:	3
Hydrophobicity:	-100	Boman Index:	-2359
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	89.17
Instability Index:	3547.5	Extinction Coefficient cystines:	0
Absorbance 280nm:	0