HORDB

ID: hor004629
Uniprot ID: Q3ECJ5
Protein name: CLAVATA3/ESR (CLE)-related protein 14
Gene name: CLE14
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE14p]: Induced by Pi starvation. |[CLE14p]: Expressed specifically in differentiating cells of the root. |[CLE14p]: Mostly expressed in roots, and, to a lower extent, in seedlings and leaves .
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0016036 cellular response to phosphate starvation; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:1900055 regulation of leaf senescence; GO:2000377 regulation of reactive oxygen species metabolic process
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: GRKLPSMTTTEEFQRLSFDGKRILSEVTADKKYDRIYGASARLVPKGPNPLHNK
Length: 54
Propeptide: MKVWSQRLSFLIVMIFILAGLHSSSAGRKLPSMTTTEEFQRLSFDGKRILSEVTADKKYDRIYGASARLVPKGPNPLHNK
Signal peptide: MKVWSQRLSFLIVMIFILAGLHSSSA
Modification: T45 Hydroxyproline;T48 Hydroxyproline
Glycosylation: T48 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Acts as an elicitor of the root meristem differentiation through the CLV2/CRN complex signaling pathway. Inhibits irreversibly root growth by reducing cell division rates in the root apical meristem.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004629_AF2.pdb

hor004629_ESM.pdb

Mass:	706452	Formula:	C270H440N80O80S
Absent amino acids:	CW	Common amino acids:	KLR
pI:	10.62	Basic residues:	12
Polar residues:	16	Hydrophobic residues:	14
Hydrophobicity:	-88.7	Boman Index:	-14211
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	66.85
Instability Index:	4368.89	Extinction Coefficient cystines:	2980
Absorbance 280nm:	56.23