HORDB

ID: hor004628
Uniprot ID: Q2V4E2
Protein name: CLE8p
Gene name: CLE8
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE8p]: Mostly expressed in siliques, and, to a lower extent, in flowers .
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0009793 embryo development ending in seed dormancy; GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0010628 positive regulation of gene expression; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0080113 regulation of seed growth; GO:2000014 regulation of endosperm development
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: RRVPTGPNPLHH
Length: 12
Propeptide: MKVLKRDSMLLLITLYFLLTTSMARQDPFLVGVEKDVVPAGTDLKQNKAKPHLPNLFRTMRRVPTGPNPLHHISPPQPGSLNYARN
Signal peptide: MKVLKRDSMLLLITLYFLLTTSMA
Modification: T4 Hydroxyproline;T7 Hydroxyproline
Glycosylation: T7 O-linked (Ara...) hydroxyproline
Mutagenesis: 7-7P->L: In cle8-1

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Positively regulates the expression of the transcription factor WOX8 and thus, regulates early embryo development .
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004628_AF2.pdb

hor004628_ESM.pdb

Mass:	157695	Formula:	C60H97N23O15
Absent amino acids:	ACDEFIKMQSWY	Common amino acids:	P
pI:	12.5	Basic residues:	4
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-140	Boman Index:	-3847
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	56.67
Instability Index:	6347.5	Extinction Coefficient cystines:	0
Absorbance 280nm:	0