General Information

  • ID:  hor004627
  • Uniprot ID:  Q2V4E2
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 8
  • Gene name:  CLE8
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE8p]: Mostly expressed in siliques, and, to a lower extent, in flowers .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0009793 embryo development ending in seed dormancy; GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0010628 positive regulation of gene expression; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0080113 regulation of seed growth; GO:2000014 regulation of endosperm development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RQDPFLVGVEKDVVPAGTDLKQNKAKPHLPNLFRTMRRVPTGPNPLHHISPPQPGSLNYARN
  • Length:  62
  • Propeptide:  MKVLKRDSMLLLITLYFLLTTSMARQDPFLVGVEKDVVPAGTDLKQNKAKPHLPNLFRTMRRVPTGPNPLHHISPPQPGSLNYARN
  • Signal peptide:  MKVLKRDSMLLLITLYFLLTTSMA
  • Modification:  T40 Hydroxyproline;T43 Hydroxyproline
  • Glycosylation:  T43 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  43-43P->L: In cle8-1

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance. Positively regulates the expression of the transcription factor WOX8 and thus, regulates early embryo development .
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2V4E2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004627_AF2.pdbhor004627_ESM.pdb

Physical Information

Mass: 800716 Formula: C308H493N95O85S
Absent amino acids: CW Common amino acids: P
pI: 11.19 Basic residues: 12
Polar residues: 15 Hydrophobic residues: 17
Hydrophobicity: -82.42 Boman Index: -13608
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 72.26
Instability Index: 6939.03 Extinction Coefficient cystines: 1490
Absorbance 280nm: 24.43

Literature

  • PubMed ID:  22427333
  • Title:  Regulation of Arabidopsis Embryo and Endosperm Development by the Polypeptide Signaling Molecule CLE8