HORDB

ID: hor004626
Uniprot ID: Q6IWB2
Protein name: CLE42p
Gene name: CLE42
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE42p]: Expressed at low levels in seedlings, roots and inflorescence.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010087 phloem or xylem histogenesis; GO:0010223 secondary shoot formation; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0051301 cell division; GO:0090506 axillary shoot meristem initiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: HGVPSGPNPISN
Length: 12
Propeptide: MRSPHITISLVFLFFLFLIIQTHQRTIDQTHQIGSNVQHVSDMAVTSPEGKRRERFRVRRPMTTWLKGKMIGANEHGVPSGPNPISNR
Signal peptide: MRSPHITISLVFLFFLFLIIQTHQ
Modification: T4 Hydroxyproline;T7 Hydroxyproline
Glycosylation: T7 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses tracheary element differentiation but promotes the formation of procambial cells.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004626_AF2.pdb

hor004626_ESM.pdb

Mass:	137164	Formula:	C50H78N16O17
Absent amino acids:	ACDEFKLMQRTWY	Common amino acids:	P
pI:	7.55	Basic residues:	1
Polar residues:	6	Hydrophobic residues:	2
Hydrophobicity:	-72.5	Boman Index:	-1390
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	56.67
Instability Index:	3022.5	Extinction Coefficient cystines:	0
Absorbance 280nm:	0