HORDB

ID: hor004625
Uniprot ID: Q6IWB2
Protein name: CLAVATA3/ESR (CLE)-related protein 42
Gene name: CLE42
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE42p]: Expressed at low levels in seedlings, roots and inflorescence.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010087 phloem or xylem histogenesis; GO:0010223 secondary shoot formation; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0051301 cell division; GO:0090506 axillary shoot meristem initiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: RTIDQTHQIGSNVQHVSDMAVTSPEGKRRERFRVRRPMTTWLKGKMIGANEHGVPSGPNPISNR
Length: 64
Propeptide: MRSPHITISLVFLFFLFLIIQTHQRTIDQTHQIGSNVQHVSDMAVTSPEGKRRERFRVRRPMTTWLKGKMIGANEHGVPSGPNPISNR
Signal peptide: MRSPHITISLVFLFFLFLIIQTHQ
Modification: T55 Hydroxyproline;T58 Hydroxyproline
Glycosylation: T58 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses tracheary element differentiation but promotes the formation of procambial cells.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004625_AF2.pdb

hor004625_ESM.pdb

Mass:	834505	Formula:	C306H503N105O92S3
Absent amino acids:	CY	Common amino acids:	R
pI:	12.07	Basic residues:	14
Polar residues:	20	Hydrophobic residues:	14
Hydrophobicity:	-98.75	Boman Index:	-19447
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	56.25
Instability Index:	4521.25	Extinction Coefficient cystines:	5500
Absorbance 280nm:	87.3